PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00941.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 916aa    MW: 101401 Da    PI: 5.1317
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00941.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.43e-173278148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g WT++Ed+ l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
  Rsa1.0_00941.1_g00003.1 32 KGQWTPQEDQVLCKAVERFQGKNWKKIAECVK-DRTDVQCLHRWQKVL 78
                             799****************************9.************986 PP

2Myb_DNA-binding58.12e-1884130148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g+W++eEd  ++ +v+++G+  W+tI ++++ gR +kqc++rw+++l
  Rsa1.0_00941.1_g00003.1  84 KGPWSKEEDNTIIALVEKYGPTKWSTICQHLP-GRIGKQCRERWHNHL 130
                              79******************************.*************97 PP

3Myb_DNA-binding52.61e-16136178145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              +++WT+eE++ l++a++ +G++ W+  ++ ++ gR+++++k++w+
  Rsa1.0_00941.1_g00003.1 136 KNAWTQEEELTLIRAHQIYGNK-WADLMKFLP-GRSDNSIKNHWN 178
                              689*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.7942778IPR017930Myb domain
SuperFamilySSF466893.52E-153085IPR009057Homeodomain-like
SMARTSM007176.2E-143180IPR001005SANT/Myb domain
PfamPF002499.5E-153278IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-213486IPR009057Homeodomain-like
CDDcd001671.19E-123578No hitNo description
PROSITE profilePS5129431.52679134IPR017930Myb domain
SuperFamilySSF466893.0E-3081177IPR009057Homeodomain-like
SMARTSM007172.6E-1783132IPR001005SANT/Myb domain
PfamPF002492.3E-1784130IPR001005SANT/Myb domain
CDDcd001672.72E-1586130No hitNo description
Gene3DG3DSA:1.10.10.604.4E-2687134IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-20135185IPR009057Homeodomain-like
PROSITE profilePS5129418.256135185IPR017930Myb domain
SMARTSM007171.4E-14135183IPR001005SANT/Myb domain
PfamPF002491.4E-14136179IPR001005SANT/Myb domain
CDDcd001677.28E-11138178No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 916 aa     Download sequence    Send to blast
MKREMKTPNL PLDGTQKGSH GRTCGPARRS TKGQWTPQED QVLCKAVERF QGKNWKKIAE  60
CVKDRTDVQC LHRWQKVLNP ELVKGPWSKE EDNTIIALVE KYGPTKWSTI CQHLPGRIGK  120
QCRERWHNHL NPAINKNAWT QEEELTLIRA HQIYGNKWAD LMKFLPGRSD NSIKNHWNSS  180
VKKKLDSYYA SGLLDQCQSS PLIPLQNKSM ASSSSWTPSS GDEGNFMQGA DAEESECSQA  240
STVFTCSKLT NDSPDEVKPA NEEFCTPEFP SGAEQQISNS PSHAESYYPS FEDVKTIVPE  300
ISCDAEPSKK YQNPIEVGTT TATEDHLQGV SDNANQDLNL DCPQLLTHDM DGDGKNEACQ  360
DFQNSVRLSD QPSLPNSDTD MHPQPQTLIT DEECCMVLFP NNMKDSYTSD GEQRQNMVNP  420
QKGKGSLCSR SAETHANETG NIPALSWHPS NSNDPTQGCT VLGATALERK TNTNDGLLTS  480
HGNDDNDGIP EQPELSYIPK GSLKLVPLNN FSSPARVKKI HFPIADKPAE KDKGTLCYEP  540
PRFSSADIPF FSCDLAPSSS DLRPEYSPFG IRQLMISSMN CTTPLRLWDS PCHDKTPDVM  600
HAAKSFSGAS SILKKRHRDF LSPVLDRRKG KMVKSAETSS LAKDFSCLDV MIDDGNTKNK  660
CASSSEDKED PREALESGVV TSTITDQGTR RSLVYHSDVE MQLSSPVETG SRQDNKVNTV  720
EVGTIPTGEI STEPPFTTDS IPLSEFAEIN TNTAESSVDI IENYSIFDGT PFKKLLETPS  780
PWKSPLLFGS FLQSPKLPPE ITFEDIGCFM SPGERSYDAI GLMKHLSEHT ATAYADALEV  840
LGNDTPETIL KKRQMNTSIQ GKENQLWPQD QLENRSQVEC RALDFSDCGT PGKAKVSSAS  900
PGCYTSPSSY LLKSCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-65321856159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-65321856159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013629449.10.0PREDICTED: myb-related protein 3R-1-like
RefseqXP_013629448.10.0PREDICTED: myb-related protein 3R-1-like
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A078I6J90.0A0A078I6J9_BRANA; BnaA08g12050D protein
STRINGBra034531.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46742649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein